Protein Info for IAI46_11855 in Serratia liquefaciens MT49

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details PF01925: TauE" amino acids 11 to 241 (231 residues), 94.4 bits, see alignment E=4.4e-31

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 60% identity to mno:Mnod_0947)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>IAI46_11855 sulfite exporter TauE/SafE family protein (Serratia liquefaciens MT49)
MTLTLPEILALLGIFMLAGTVKGVIGLGLPTVSMGLLSLLMSPAQAAALLLVPSLVTNFW
QLFTGPDVRALCRRLWPMMACVAMGTMLTTGTLTTGQNRLAPIALGVCLVVYALLGFSRF
QWRLSPRAERRLGPLCGVLTGLITGATGVFVIPAVPYLNALGLARDDLVQALGLSFTVST
LALAAGLAWQHALPGALLGTSLLALLPALVGMWLGSVLRRHCRPAVFRRCFFIGLLVLGI
EIVWKGIN