Protein Info for IAI46_11840 in Serratia liquefaciens MT49

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 26 to 72 (47 residues), 26.4 bits, E=5.4e-10
• PF01799: Fer2_2
  • amino acids 92 to 165 (74 residues), 108.7 bits, E=1.3e-35

Best Hits

Swiss-Prot: 73% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 93% identity to spe:Spro_2314)

MetaCyc: 73% identical to nicotinate hydroxylase small subunit (Pseudomonas putida KT2440)
NICOTINATE-DEHYDROGENASE-RXN [EC: 1.17.2.1]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

• nicotinate degradation I (6/6 steps found)
• superpathway of nicotinate degradation (6/18 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.17.2.1 or 1.3.99.16

Protein Sequence (180 amino acids)

>IAI46_11840 (2Fe-2S)-binding protein (Serratia liquefaciens MT49)
MAISEVQSPREGAVKTLTEHPLMLSVNGENIHTWVMADTPLLLVLRNDLALNGPKYGCGL
GECGACTVLVDGIAARSCVIPALGVTGREVTTLEGLGDRQHLHPVQRAFIEEQAAQCGYC
LNGMIMTTKALLDRNPSPSDTEIRQALSGNLCRCGTHIEILRAVQRAITLYRNEETSSHD