Protein Info for IAI46_11820 in Serratia liquefaciens MT49

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 27 to 251 (225 residues), 75.5 bits, E=7.9e-25
• PF12146: Hydrolase_4
  • amino acids 28 to 247 (220 residues), 52.2 bits, E=8e-18
• PF12697: Abhydrolase_6
  • amino acids 29 to 255 (227 residues), 70.8 bits, E=4e-23

Best Hits

Swiss-Prot: 69% identical to NICD_PSEPK: N-formylmaleamate deformylase (nicD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 90% identity to spe:Spro_2310)

MetaCyc: 69% identical to N-formylmaleamate deformylase (Pseudomonas putida KT2440)
RXN-11318 [EC: 3.5.1.106]

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

MetaCyc Pathways

• nicotinate degradation I (6/6 steps found)
• picolinate degradation (5/7 steps found)
• nicotine degradation II (pyrrolidine pathway) (6/11 steps found)
• nicotine degradation III (VPP pathway) (5/10 steps found)
• superpathway of nicotinate degradation (6/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.106

Protein Sequence (264 amino acids)

>IAI46_11820 alpha/beta hydrolase (Serratia liquefaciens MT49)
MSHFLYGANVQANGIRQHYLRYGGQGPVVILIPGITSPAITWGFVAERLAEKYDTYVLDV
RGRGLSASGPDLAYDAETCAQDITSFACALQLENYALLGHSMGARFALRAAALHPAGVRR
LVLIDPPVSGPGRREYPGKWPWYVDSIRQSLLGMNAEQMRTYCPNWSESQRQLRAEWLHT
CYEPAIQRAYEDFHEVDSHRDYPALSMPTLLMVAGLGGVIQQEDEAEIRALQPEITLAHV
ENAGHMIPWDDFDGFFRALGNFLD