Protein Info for IAI46_11805 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 391 (362 residues), 156.9 bits, see alignment E=3.4e-50

Best Hits

Swiss-Prot: 81% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_2307)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>IAI46_11805 MFS transporter (Serratia liquefaciens MT49)
MAIVETPLTGKAGAESLLYRKITWKLIPFLCLCYLAAYLDRINVGLAKLQMADQLQLSEA
AFGLGAGLFFVGYILFEVPSNLILQRVGAKVWIARIMITWGLLSACTMFVTTPNQFYIIR
FLLGVAEAGFLPGVLYYLTLWFPTYRRGRIIALFMIGLPLSSVLGGPLSGWIMGHFDMRH
GLHGWQWLFLLEGIPSVLLGVLTFWVLPNNYRQAKWLSEDEKQRIADDLAQDDAEASHSK
HSFRDGFFNLKVWMLGGIDFSILLSAYAMGFWMPTFIKTAGVTNITTIGLLTALPSVAAL
LGMLLIGTSSDRMRERRWHIIVPFIVGAMAMAGSTFFTHNVIATVLLFSVAQAAIIGAVP
VFFSLPATFLRGTAAATGFALACSLANIAGLVSNSLMGLALDLTGKSGGALWAFAGCLLI
SSLLVVALPAKVVNR