Protein Info for IAI46_11765 in Serratia liquefaciens MT49

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 288 (201 residues), 84.9 bits, see alignment E=3e-28

Best Hits

Swiss-Prot: 32% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 97% identity to srs:SerAS12_2248)

Predicted SEED Role

"Glucosamine ABC transport system, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>IAI46_11765 sugar ABC transporter permease (Serratia liquefaciens MT49)
MLTLPQRERRQAWVLLAPMLLMMLLLTAWPLGRTLWLSFTDAALVGDGVAPAWVGADNFL
YALTDPDFQAALGRTLYFTLVSVAFEGVIGVLVALLLNQKFHGRNLLRVLVILPWALPTI
VNATMWRLNFNPDYGSINALLTQLGVIDHYRSWLGDPASALNAVMLADIWKNYPLITLLT
LAALQTIPDDLYEAARLDGASAWRRFRAITLPAILAPLAVALVLRTIDAFKVFDIIYVMT
RGGPMDSTKTLSFFVYQESFSYLRAGSGAAYAVLMTLLCGVLIALYMLMLFRQRRRSLAD
EA