Protein Info for IAI46_11760 in Serratia liquefaciens MT49

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 71 to 97 (27 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 271 (182 residues), 49.2 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 96% identity to spe:Spro_2295)

Predicted SEED Role

"Glucosamine ABC transport system, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>IAI46_11760 carbohydrate ABC transporter permease (Serratia liquefaciens MT49)
MKPKLRLLLRYGAALLLAVSILAPMLWLFLMSVSSSADLTRVPLEWLPRHWDFSRYVSLL
SLQPGQPGALFLHALFNSLLVACGATLISLLLAIPAAFSFSRYPGRDGWLFASLAIYMVP
PVAFVLPLYFILQQLALLNTHIGLVLVYCSLILPFLTWMLKNQFDALPIDIEQAARLDGL
RQWQVLLRITLPLAKPALGASALFGWLLAWDEFFYALLFTSNIQAQTLPVTIAGFTAGRA
TDDGLIAAVGILAAIPPLFIALWLQKTLVSGLTSGGSKG