Protein Info for IAI46_11720 in Serratia liquefaciens MT49

Annotation: bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 2 to 187 (186 residues), 180.4 bits, E=9.9e-57
• PF02719: Polysacc_synt_2
  • amino acids 3 to 167 (165 residues), 23.8 bits, E=8.3e-09
• PF01370: Epimerase
  • amino acids 3 to 136 (134 residues), 36.6 bits, E=1.2e-12
• PF08659: KR
  • amino acids 4 to 162 (159 residues), 54.2 bits, E=6.1e-18
• PF13561: adh_short_C2
  • amino acids 7 to 220 (214 residues), 123.6 bits, E=3.5e-39
• PF13460: NAD_binding_10
  • amino acids 7 to 139 (133 residues), 32.2 bits, E=3.5e-11

Best Hits

Swiss-Prot: 75% identical to YDFG_ECOL6: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 97% identity to spe:Spro_2290)

MetaCyc: 75% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"3-hydroxypropionate dehydrogenase (EC 1.1.1.298)" (EC 1.1.1.298)

MetaCyc Pathways

• superpathway of L-threonine metabolism (15/18 steps found)
• uracil degradation III (5/5 steps found)
• L-threonine degradation III (to methylglyoxal) (2/3 steps found)
• β-alanine degradation III (1/2 steps found)
• aminopropanol phosphate biosynthesis II (2/4 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Protein Sequence (249 amino acids)

>IAI46_11720 bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG (Serratia liquefaciens MT49)
MIIFVTGATSGFGESITRRFIREGHQVIASGRRIERLEELKDELGEALHIVRLDVRNRAA
IQQVIDELPAALRQIDVLVNNAGLALGLEPAHKANADDWETMIDTNAKGLVNMTRALLPA
MVERNVGHVINIGSVAANWPYAGGNVYGATKAFVKQFSLGLRADLHGTRIRVTDIEPGLV
GGTEFSNVRFKGDDGKVDKVYDGANALTPEDIAESVFWVATLPAHVNINSLEIMPVSQSF
AGLNIHREA