Protein Info for IAI46_11675 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF07690: MFS_1" amino acids 42 to 259 (218 residues), 111.5 bits, see alignment E=4.4e-36 amino acids 251 to 414 (164 residues), 50.7 bits, see alignment E=1.3e-17 PF00083: Sugar_tr" amino acids 86 to 219 (134 residues), 43 bits, see alignment E=3e-15

Best Hits

Swiss-Prot: 76% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 98% identity to spe:Spro_2281)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>IAI46_11675 MFS transporter (Serratia liquefaciens MT49)
MPSTLAANDDAAAAPKTQRSTLNKLPYIERGTPQFMRVTLALFSAGLATFALLYCVQPIL
PVLSQDFGISPAESSLSLSVSTGLLALGLMFTGPLSDAIGRKPVMVVALLLAAICTLICA
FMTSWQGILLMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLV
TGVLTDFFSWRVSLAVIGLFALAAACMFWRILPASKHFRASSLRPRTLLINFRLHWHDKG
LPLLFAEGFLLMGSFVTMFNYIGYRLLADPYHLSQAIVGLLSVVYLTGSYSSPKAGAMTS
RFGRGPVLLASTLIMLIGILITALAPVAVIFIGMMLFTAGFFAAHSVASSWIGRRARRAK
GQASSLYLFCYYVGSSVAGTLGGVFWHSFGWNGVVAFISVMLLLALLVVHYLKKLPEAAR
V