Protein Info for IAI46_11645 in Serratia liquefaciens MT49

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20511: PMI_typeI_cat
  • amino acids 1 to 150 (150 residues), 140.3 bits, E=9.7e-45
• TIGR00218: mannose-6-phosphate isomerase, class I
  • amino acids 2 to 385 (384 residues), 390.2 bits, E=5e-121
• PF20512: PMI_typeI_hel
  • amino acids 157 to 236 (80 residues), 47.5 bits, E=4.1e-16
• PF21621: MPI_cupin_dom
  • amino acids 311 to 389 (79 residues), 90.3 bits, E=1.3e-29
• PF01238: PMI_typeI_C
  • amino acids 311 to 355 (45 residues), 30.9 bits, 4.6e-11

Best Hits

Swiss-Prot: 75% identical to MANA_SALTY: Mannose-6-phosphate isomerase (manA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 97% identity to spe:Spro_2277)

MetaCyc: 74% identical to mannose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• GDP-mannose biosynthesis (4/4 steps found)
• D-mannose degradation I (2/2 steps found)
• D-mannose degradation II (2/2 steps found)
• mannitol degradation II (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• mannitol biosynthesis (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (6/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Protein Sequence (392 amino acids)

>IAI46_11645 mannose-6-phosphate isomerase (Serratia liquefaciens MT49)
MQKMTNAVQNYAWGSHDALTQLYGIANPQGLPMAELWMGAHPKSSSRVAGTDGNLRSLRD
VIDEDQPKQLGAEVARRFGELPFLFKVLCADQPLSIQVHPSKSAAVAGFAKENAAGIPLD
AAERNYKDPNHKPELVFALTPFLAMNGFRELSDIVSLLQPIAGAHHDIAAFLQQPDVSHL
SALFASLLAMSGEQKSLALGVLKAALNNQQGETWDTVRFIAGFYPDDSGLFSPLLLNVVQ
LQPGEAMFLYAETPHAYLKGVALEVMANSDNVLRAGLTPKFIDIPELLANLQFRPQPASG
LLTQPQKRGDELFFPIPVEDFAFSLHDLSAAPQALAQDSAAIVFCVEGEAVLSKQDQQLV
LKPGESCFIGAFESPVSVSGTGRIARVYNLLA