Protein Info for IAI46_11620 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 321 (313 residues), 127.6 bits, see alignment E=2.8e-41

Best Hits

KEGG orthology group: None (inferred from 52% identity to bpt:Bpet1436)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI46_11620 MFS transporter (Serratia liquefaciens MT49)
MPLAVYILGLAIFSIGTAELMVAGMMSTLSEAFSITVGEVGHLISYYAFGVMLGGPVLTY
FFLKFKAPYRTTLLWLLALYVVVQGLSAFISDYSILVAIRIVTGILCAGCLSLSLATSMA
LVPIQHRPRAASIVIGGFMVSNVFGVPLATIIDQHWGWRITFGLVAVLVFICLLALVRLL
PAIAAGRTLKMAEEIKAFKNKAYWKACTTSCLILGASFAAFSYFVPVLVDVSGFSMQAVP
FILMLYGLANIVGNMITGRLAYRHSLAIMVVGLSILSLSLFGMALFAEYPLIAICAVILI
GLSGVPMNPAMMARIVSVAHPGPMVNAVHTSVINIGLGGGSYLGGMAIASGYGLRSALWI
GMALAVLALLSILPYLRRGQQGWR