Protein Info for IAI46_11610 in Serratia liquefaciens MT49

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 92 to 110 (19 residues), see Phobius details PF00126: HTH_1" amino acids 7 to 66 (60 residues), 68.9 bits, see alignment E=2.8e-23 PF03466: LysR_substrate" amino acids 91 to 286 (196 residues), 126.4 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 68% identical to AMPR_CITKO: HTH-type transcriptional activator AmpR (ampR) from Citrobacter koseri

KEGG orthology group: None (inferred from 94% identity to spe:Spro_2272)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>IAI46_11610 LysR family transcriptional regulator (Serratia liquefaciens MT49)
MRNRLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRTLEQQLGIQLFRRLPRGLD
LTEEGQALLPILTDAFDRIESVLQQFEGGHFHEVLTVAVVGTFAVGWLMPRLAAFRASHP
FIDLRVLTNNNLVNLSADGMDFAIRFGEGRWPATHNLKLFDAPLTVLCPPEIAQRLRTPQ
DLQYELLMRSYRKDEWERWFTAAQVTPWRINGPVFDSSRLMVEGAIHSGGVALAPARMFA
RELREGILQRPFAAEANLGAYWLTHLKSRDMTPAMKVFVGWIQQQANEESA