Protein Info for IAI46_11585 in Serratia liquefaciens MT49

Annotation: NUDIX domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 7 to 189 (183 residues), 154.4 bits, E=1.3e-49
• PF00293: NUDIX
  • amino acids 48 to 167 (120 residues), 27.9 bits, E=1.1e-10

Best Hits

Swiss-Prot: 61% identical to NUDK_PECAS: GDP-mannose pyrophosphatase NudK (nudK) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 90% identity to spe:Spro_2260)

MetaCyc: 50% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Protein Sequence (198 amino acids)

>IAI46_11585 NUDIX domain-containing protein (Serratia liquefaciens MT49)
MIATQDRVRIVETRVLSDDWYLLKKTTFDFLRRDGVWQRQSRETYDRGDGATILLFNRQR
QKVVLTRQFRFPAFVNGHDGMLIEAAAGLLDNASPEERIRAEAEEETGYIVQNVQKVFEA
YMSPGSVTEKLHFFVGEYQADERVSNGGGVEAEGEDLEVLELPLADALRAVSQGTIVDAK
TIMLLQFVALNHTLEKRL