Protein Info for IAI46_11535 in Serratia liquefaciens MT49

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 33 to 33 (1 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF13593: SBF_like" amino acids 10 to 319 (310 residues), 379.9 bits, see alignment E=1.1e-117 PF01758: SBF" amino acids 43 to 217 (175 residues), 37.3 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 67% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 98% identity to spe:Spro_2250)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>IAI46_11535 bile acid:sodium symporter (Serratia liquefaciens MT49)
MSWLQRLRIDKFLLVLILVVIVASVFPCEGRWATFFEHLTTAAIALLFFMHGAKLSREAI
IAGMGHWKLHLVVFLSTFALFPLLGLAMNLMVPGLMTPTVYLGFLYLCALPATVQSAIAF
TSAAGGNVAAAVCSASASSILGVFLSPLLVGALMHTQGGNTDVLHAIGSIILKLMVPFVV
GHLARPLIGKWVDRHRKLINLTDRSSILLVVYTAFSAAVVEGIWHKIDGWSLLTILVMSL
VLLTVVLIINTYAARWLGFNTADEITIVFCGSKKSLANGIPMANVLFPAAAVGAMVLPLM
IFHQVQLMVCAVLAQRYARKTAKQRAEAGALTAK