Protein Info for IAI46_11525 in Serratia liquefaciens MT49

Annotation: arabinose operon transcriptional regulator AraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF02311: AraC_binding" amino acids 27 to 162 (136 residues), 81.3 bits, see alignment E=8.5e-27 PF12833: HTH_18" amino acids 205 to 284 (80 residues), 77.5 bits, see alignment E=1.2e-25 PF00165: HTH_AraC" amino acids 244 to 283 (40 residues), 37.3 bits, see alignment 3.3e-13

Best Hits

Swiss-Prot: 85% identical to ARAC_DICCH: Arabinose operon regulatory protein (araC) from Dickeya chrysanthemi

KEGG orthology group: K02099, AraC family transcriptional regulator, arabinose operon regulatory protein (inferred from 98% identity to spe:Spro_2248)

Predicted SEED Role

"Arabinose operon regulatory protein" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>IAI46_11525 arabinose operon transcriptional regulator AraC (Serratia liquefaciens MT49)
MYHRMAQEPQPNPLLPGYTFNAYLVAGLTPIMADGPLDFFIDRPGGMKGYILNLTIKGQG
KVFDGEDTLYCNPGDLLLFPPKAAHYYGRSPDSDCWYHRWVYFRPRAYWADWLEWHSKTH
EVGRLTLPNNNLLLEFDRLFANIEQTQRSGRRFAEELGMNLLERLLLRAMEEDPLSPQKI
MDPRVIEACQFITGNLAGELRIDEVARHVCLSPSRLAHLFREQVGINILRWREDQRVIRA
KLLLQTTQESIATIGRVVGYDDQLYFSRVFRKRVGVSPSDFRRRSLEINYPARNQRETPY
AVATN