Protein Info for IAI46_11470 in Serratia liquefaciens MT49

Annotation: electron transport complex subunit RsxD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 84 to 100 (17 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 16 to 359 (344 residues), 376.1 bits, see alignment E=6.9e-117 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 19 to 360 (342 residues), 464.2 bits, see alignment E=1.3e-143

Best Hits

Swiss-Prot: 76% identical to RNFD_YERP3: Ion-translocating oxidoreductase complex subunit D (rnfD) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 97% identity to srs:SerAS12_2187)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>IAI46_11470 electron transport complex subunit RsxD (Serratia liquefaciens MT49)
MKFRPVQQTAAKGLHIASSPFTHNQQSTSRIMLWVMLACIPGVAAQVWFFGYGTLIQTAL
AMLVALLAEGAILALRKLPVRTRLADNSALLTALLLGISLPPLAPWWMIVIGTFFAIVIA
KQLYGGLGQNPFNPAMVGYVVLLIAFPVQMTSWLPPDELRATALSFQDTLLAIFSGHTAQ
GATIHELQMGIDGISQATPLDGFKTGLRSGHSVEQVLQQPLFGGALAGIGWQWVNLGFLA
GGLFMLARRLIHWQIPFSMLAAIAVCSGLAWWLDPLQQASPLIHLFSGASMLGAFFIATD
PVSASTTPKGRLIYGALIGVLVWLIRVYGGYPDGVAFAVLLANITVPLIDHYTQPRVYGH
R