Protein Info for IAI46_11450 in Serratia liquefaciens MT49

Annotation: dipeptide/tripeptide permease DtpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 457 to 479 (23 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 19 to 487 (469 residues), 463.3 bits, see alignment E=5.6e-143 PF07690: MFS_1" amino acids 37 to 371 (335 residues), 57.4 bits, see alignment E=1.2e-19 PF00854: PTR2" amino acids 91 to 450 (360 residues), 312.4 bits, see alignment E=4.5e-97

Best Hits

Swiss-Prot: 97% identical to DTPA_SERP5: Dipeptide and tripeptide permease A (dtpA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 97% identity to spe:Spro_2233)

MetaCyc: 77% identical to dipeptide/tripeptide:H+ symporter DtpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease DtpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>IAI46_11450 dipeptide/tripeptide permease DtpA (Serratia liquefaciens MT49)
MSTANNNSEQPESVSLNAFKQPKAFYLIFSIELWERFGYYGLQGIMAVYLVKMLGLSEAD
SITLFSSFSALVYGFVAIGGWLGDKVLGSKRVIVLGALVLAVGYAMVAYSGHEIFWVYLG
MATIAVGSGLFKANPSSLLSTCYEKDDPRLDGAFTMYYMSVNIGSFLSMLATPWLAAKYG
WSVAFSLSVVGMLITLVNFMVCHKWVKQHGSKPDFKPLQVKKLLMVLVGVVALVAISSWL
LHNQVIARWALAIISIGIVIVFAKETFALHGAARRKMIVAFLLMLEAVVFFVLYSQMPTS
LNFFAIHNVEHSILGIGFEPEQYQALNPFWIMLASPILAALYNKMGDRLPMPHKFAFGMI
LCSGAFLVLPWGASFANEQGIVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGF
IMGSWFLTTAAAALIAGKVAGLTAVPSNVNDAHASLAIYSHVFMQIGIATAVIAILMMLT
APKLYRMTLDTAEDTNKKAQAAAAAN