Protein Info for IAI46_11350 in Serratia liquefaciens MT49

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03702: AnmK
  • amino acids 5 to 366 (362 residues), 558.6 bits, E=3.3e-172

Best Hits

Swiss-Prot: 95% identical to ANMK_SERP5: Anhydro-N-acetylmuramic acid kinase (anmK) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 95% identity to spe:Spro_2216)

MetaCyc: 73% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (13/14 steps found)
• peptidoglycan recycling II (6/10 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Protein Sequence (373 amino acids)

>IAI46_11350 anhydro-N-acetylmuramic acid kinase (Serratia liquefaciens MT49)
MKSGRYIGVMSGTSLDGVDVVLAAIDGRMVAQQASYSHPMPIQLKQDILGMCQGQQTTLA
AVGRLDAQLGTLFGEAVLGLLKQTGVAPQDITAIGCHGQTVWHEPEGDARFSMQLGDNNR
IAALTNITTVGDFRRRDMAYGGQGAPLVPAFHQALLAHPVERRMVLNIGGIANLSMLLPG
APVRGFDTGPGNMLMDAWIWRHHSQPYDKDGAWAMEGRVCLPLLQQMLADPYFALPAPKS
TGREYFNAAWLENQLSGLPAVKPVDVQTTLAELTAVTICEQVQLAGGCERLLVCGGGARN
PLLMARMSALLPGTEVCLTDDFGISGDDMEALAFAWLAFRTLSGQPGNLPSVTGASRETL
LGGIYPVLPLGGR