Protein Info for IAI46_11330 in Serratia liquefaciens MT49

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF16576: HlyD_D23" amino acids 43 to 230 (188 residues), 49.5 bits, see alignment E=5e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 230 (187 residues), 124.8 bits, see alignment E=1.9e-40 PF13533: Biotin_lipoyl_2" amino acids 45 to 92 (48 residues), 45 bits, see alignment 1.1e-15 PF13437: HlyD_3" amino acids 153 to 234 (82 residues), 36.9 bits, see alignment E=7.6e-13

Best Hits

Swiss-Prot: 65% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to spe:Spro_2212)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>IAI46_11330 HlyD family secretion protein (Serratia liquefaciens MT49)
MTYKTLKYFSTVIVCAIAICAGWWLWNYYMQSPWTRDGKVRAELVNITPEVSGRLEKITV
HDNQFIPAGSLIFTIDPVPYQIALDNAEAALAKAQSDLAKADHEAARRRGLPRNVISAED
MDESNLAAQAMKAAYKAAQANLEQAKWNLSKTKIYAPTDGYITNLQTRVGNYASVGSPLV
ALVDVHSFYVLGYFEETKLKHIKEGNKADIVLYNGNTPLQGEVESIGRAIYDQSVESSSD
LLMDVKPNVPWVRLAQRVPVRIKLLNVPADLPLVAGTTCTISIHQ