Protein Info for IAI46_11290 in Serratia liquefaciens MT49

Annotation: phosphoethanolamine transferase EptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 56 to 208 (153 residues), 163.5 bits, see alignment E=3.4e-52 PF00884: Sulfatase" amino acids 236 to 526 (291 residues), 221.4 bits, see alignment E=1.7e-69

Best Hits

Swiss-Prot: 51% identical to EPTA_SALTY: Phosphoethanolamine transferase EptA (eptA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_2145)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>IAI46_11290 phosphoethanolamine transferase EptA (Serratia liquefaciens MT49)
MWLRQRLQCNSLGFILASALFFTLFQNALFLHKAWSYISFDNVHSVIFAATMPVVIFCAL
NIIFSVLTVPFLRKPLMIFFLLGSAAANYFMFSYGVVIDGNMMQNAFETNPQEATALLTP
RMGLWLVLLGILPAVVVCFTDIRKTRPWWYMAGLRAANVMLSVVVILIIAALFYKDYASL
IRNNKSVVKMLTPSNFVAGTIKFTQQRYFTRNLPLVKIGEDARKGPLIASQQKKTLVILV
VGETARAENFSLGGYGRETNPRLKQDNVTYFKNASSCGTETAISVPCMFSNMPRKDYDAT
LATHQEGVLDVLAHAGVNVLWRENDGGCKGACDRVPHVDMTKLKLPQDCDGDVCMDNVLL
YKLNGYINSLKDDGVIVLHQMGSHGPAYYRRSTPEFRKFSPTCDSNQIQDCTHEQLVNTY
DNSLLYTDAMLDDTIKLLQQYSGKFNTALVYLSDHGESLGENGMYLHGTPYVFAPSQQTH
VPFLMWMSADYERNFKIDRQCLNNMAEKDEVSQDNLFHTLLGMMNVQTREYQSQLDILQR
CRSGS