Protein Info for IAI46_11265 in Serratia liquefaciens MT49

Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR01298: ribonuclease T" amino acids 21 to 219 (199 residues), 350.6 bits, see alignment E=1.2e-109 PF16473: Rv2179c-like" amino acids 31 to 203 (173 residues), 33.6 bits, see alignment E=3.3e-12 PF00929: RNase_T" amino acids 31 to 205 (175 residues), 99.6 bits, see alignment E=3e-32

Best Hits

Swiss-Prot: 88% identical to RNT_YERP3: Ribonuclease T (rnt) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 97% identity to spe:Spro_2199)

MetaCyc: 81% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>IAI46_11265 ribonuclease T (Serratia liquefaciens MT49)
MRAAFDEDKKLMAEKSDLNALSGRFRGFYPVVIDIETAGFNAKTDALLEIAAVTLKMDEN
GWLQQDETLHFHVEPFEGANLQPEALAFNGIDPSNPLRGAVSEHDALHAIFKAVRKGIKD
RGCNRAIIVAHNANFDHSFLMAAAERASLKRNPFHPFATFDTAALSGLVLGQTVLAKACI
AANIPFDSSQAHSALYDTEQTALLFCELVNRWKRLGGWPLAVENTD