Protein Info for IAI46_11260 in Serratia liquefaciens MT49

Annotation: Grx4 family monothiol glutaredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 5 to 101 (97 residues), 157 bits, see alignment E=5.5e-51 PF00462: Glutaredoxin" amino acids 17 to 81 (65 residues), 73.8 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 93% identical to GLRX4_ECOLI: Glutaredoxin 4 (grxD) from Escherichia coli (strain K12)

KEGG orthology group: K07390, monothiol glutaredoxin (inferred from 97% identity to spe:Spro_2198)

Predicted SEED Role

"Glutaredoxin-related protein" in subsystem Glutaredoxins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>IAI46_11260 Grx4 family monothiol glutaredoxin (Serratia liquefaciens MT49)
MTTTIEKIQHQIAENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRA
ELPKYANWPTFPQLWVDGELVGGCDIIIEMYQRGELQQLIKETAEKYKQQEDQQP