Protein Info for IAI46_11240 in Serratia liquefaciens MT49

Annotation: HTH-type transcriptional repressor PurR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00356: LacI
  • amino acids 3 to 48 (46 residues), 67.7 bits, 1.2e-22
• PF00532: Peripla_BP_1
  • amino acids 59 to 325 (267 residues), 117.8 bits, E=1.3e-37
• PF13407: Peripla_BP_4
  • amino acids 62 to 307 (246 residues), 69.3 bits, E=8.3e-23
• PF13377: Peripla_BP_3
  • amino acids 171 to 331 (161 residues), 144.1 bits, E=8.9e-46

Best Hits

Swiss-Prot: 98% identical to PURR_SERP5: HTH-type transcriptional repressor PurR (purR) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03604, LacI family transcriptional regulator, purine nucleotide synthesis repressor (inferred from 98% identity to spe:Spro_2195)

MetaCyc: 83% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Purine nucleotide synthesis repressor" in subsystem Purine nucleotide synthesis regulator

Protein Sequence (341 amino acids)

>IAI46_11240 HTH-type transcriptional repressor PurR (Serratia liquefaciens MT49)
MATIKDVAKRAGVSTTTVSHVINKTRFVAEETKAAVGAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQRAYLAMLAQKRVDGLL
VMCSEYPDQLLGMLEDYRNIPMVVMDWGAARGDFTDTIIDNAFEGGYLAGRYLIERGHRD
IGAIPGQLARNTGGGRHQGFLKAMEEANIDVREEWIVQGDFEPESGYKAMHQILSQKQRP
TAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFTPALTTIHQPKERLGEM
AFTMLLDRIISKREESQVIEVHPKLVERRSVADGPFIDYRR