Protein Info for IAI46_11185 in Serratia liquefaciens MT49

Annotation: pyruvate kinase PykF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 1 to 325 (325 residues), 487.8 bits, E=1.5e-150
• TIGR01064: pyruvate kinase
  • amino acids 2 to 469 (468 residues), 620 bits, E=1.2e-190
• PF02887: PK_C
  • amino acids 356 to 468 (113 residues), 99 bits, E=1.9e-32

Best Hits

Swiss-Prot: 88% identical to KPYK1_ECO57: Pyruvate kinase I (pykF) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_2129)

MetaCyc: 88% identical to pyruvate kinase 1 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• heterolactic fermentation (15/18 steps found)
• Rubisco shunt (9/10 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycolysis IV (8/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (470 amino acids)

>IAI46_11185 pyruvate kinase PykF (Serratia liquefaciens MT49)
MKKTKIVCTIGPKTESEEMLTNLLNAGMNVMRLNFSHGDYEEHGNRIKNMRAVMAKTGQN
AGILLDTKGPEIRTMKLEGGKDASLVAGQTFTFTTDQSVIGNNERVAVTYAGFSADLKIG
NTVLVDDGLIGMEVTNVTENEVVCKVLNSGDLGENKGVNLPGVSIQLPALAEKDKRDLIF
GCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEQIQIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLEAVTIMATICERTDRVMPSRIDSLNDNRKLRITEAVCR
GAVETAEKLDAPLIVVATSGGKSAKSVRKYFPNAVILALTTNEVTAHQLILSKGVIPQMV
KEIASTDDFYRIGKEAALASGLAQKGDVVVMVSGALVPSGTTNTASVHVL