Protein Info for IAI46_11160 in Serratia liquefaciens MT49

Annotation: Fe-S cluster assembly protein SufD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR01981: FeS assembly protein SufD" amino acids 137 to 414 (278 residues), 288.2 bits, see alignment E=3e-90 PF01458: SUFBD" amino acids 175 to 398 (224 residues), 244.3 bits, see alignment E=6e-77

Best Hits

Swiss-Prot: 63% identical to SUFD_ECOLI: FeS cluster assembly protein SufD (sufD) from Escherichia coli (strain K12)

KEGG orthology group: K09015, Fe-S cluster assembly protein SufD (inferred from 94% identity to spe:Spro_2182)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>IAI46_11160 Fe-S cluster assembly protein SufD (Serratia liquefaciens MT49)
MAGLPTNNNSRALQQLYSLFEERGGEHSAHALAHWQQALRLGWPTRKHENWKYTPLEGLL
EQQFLEPPVEQVTTAQVDALALAIDAYRLVFIDGRFSAALSDGELGDYQFDVASYGTPQA
LPEPIQPEIFLHLTESLAQETSIIRVAAGKSASRPLYLLHISSGRGAAGEVNTVHHRHHL
EIGRSAQAEVIEHYVSLNDAAHFTGARLTANVADNAQLHHCKLAFESQPSYHFAHNDLVI
GRDAQVKSDSFLLGAGLTRHNTSAQLNGEGSNLVINSLVLPVGKEVCDTRTYLEHNKGYC
ESRQLHKVVVSDRAKAVFNGMIKVAKHAIKTDGQMTNHNLLLGKVAEVDTKPQLEIYADD
VKCSHGATVGRIDEEQLFYLQSRGIDKHAAQQMIIFAFAAELTEGIGNETIRESVLARIA
RRLPEPGEAA