Protein Info for IAI46_11155 in Serratia liquefaciens MT49

Annotation: Fe-S cluster assembly ATPase SufC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01978: FeS assembly ATPase SufC" amino acids 2 to 244 (243 residues), 371.2 bits, see alignment E=1e-115 PF00005: ABC_tran" amino acids 17 to 171 (155 residues), 67.7 bits, see alignment E=8.6e-23

Best Hits

Swiss-Prot: 84% identical to SUFC_ECOLI: Probable ATP-dependent transporter SufC (sufC) from Escherichia coli (strain K12)

KEGG orthology group: K09013, Fe-S cluster assembly ATP-binding protein (inferred from 98% identity to spe:Spro_2181)

Predicted SEED Role

"Iron-sulfur cluster assembly ATPase protein SufC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>IAI46_11155 Fe-S cluster assembly ATPase SufC (Serratia liquefaciens MT49)
MLSIKNLKVSAEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSATLAGREEYEVTEGEV
TFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFFLQTSVNAVRKYRQQEALDRFDF
ADFIEEKIELLNMPPDLLTRSVNVGFSGGEKKRNDILQMAALEPDLCILDETDSGLDIDA
LKIVANGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLSQGRIVKSGDFSLVKQLEEQG
YGWLTDEQ