Protein Info for IAI46_11110 in Serratia liquefaciens MT49

Annotation: kinase/pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF03618: Kinase-PPPase" amino acids 5 to 263 (259 residues), 256 bits, see alignment E=2.4e-80

Best Hits

Swiss-Prot: 90% identical to PSRP_YERE8: Putative phosphoenolpyruvate synthase regulatory protein (YE2177) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K09773, hypothetical protein (inferred from 99% identity to srs:SerAS12_2115)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>IAI46_11110 kinase/pyrophosphorylase (Serratia liquefaciens MT49)
MERSVFYISDGTAITAEVLGHAVLSQFPVKATTFTLPFVETEARARGVCQQINDIYRDTG
VRPLVFYSIISPEVRKVITQSEGFCQDIVQALVGPLQGELEVEPTPVPNRTHGLTASNLG
KYDARIAAIDYTLAHDDGISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFT
ADDMDNLHLPAALKPFQHKLFGLTIDPERLAAIREERRENSRYASIRQCRMELAEVEALF
RKNQIRYLNTTNYSVEEISTKILDILGMSRRMF