Protein Info for IAI46_11085 in Serratia liquefaciens MT49

Annotation: hemin-degrading factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF06228: ChuX_HutX" amino acids 25 to 153 (129 residues), 107.6 bits, see alignment E=4.6e-35 amino acids 205 to 331 (127 residues), 88.5 bits, see alignment E=3.6e-29 PF05171: HemS" amino acids 29 to 156 (128 residues), 139.2 bits, see alignment E=7.3e-45 amino acids 206 to 337 (132 residues), 135.6 bits, see alignment E=9.4e-44

Best Hits

Swiss-Prot: 73% identical to HEMS_YEREN: Hemin transport protein HemS (hemS) from Yersinia enterocolitica

KEGG orthology group: K07225, putative hemin transport protein (inferred from 94% identity to spe:Spro_2168)

MetaCyc: 63% identical to heme oxygenase (hematinate-forming) (Escherichia coli O157:H7)
RXN-17522

Predicted SEED Role

"Hemin transport protein HmuS" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>IAI46_11085 hemin-degrading factor (Serratia liquefaciens MT49)
MSNTLYQRYQQAKIDNPGKYARDLAELLGVSEAELTHARVGRDTRRLQADARTLLTELEQ
VGVTKSITRNSYAVHEQMGRYLNQHLNGHAGLILNPRELDLRLFLNQWASAFAMSETNKR
GVRHSIQFFDHQGDALHKVYTTDETDLAAWMALVERHLSAENPALALKAPDATVSNAAPD
NEKIDREWREMTDVHQFFQLLSRNKLTRQQAFKAVGNDLAYRVDNSALSQLLNAALDLQN
EIMIFVGNRGCVQIFTGQIERLMPQEGWINVFNRRFTLHLIEDAIAESWITRKPTKDGFV
TSLELFAADGTQIAQLYGQRTEGQPEQTHWREQVAALEPKDIAA