Protein Info for IAI46_11015 in Serratia liquefaciens MT49

Annotation: UDP-4-amino-4-deoxy-L-arabinose aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF01041: DegT_DnrJ_EryC1" amino acids 11 to 373 (363 residues), 431.4 bits, see alignment E=4.7e-133 PF01212: Beta_elim_lyase" amino acids 33 to 210 (178 residues), 30.9 bits, see alignment E=2.7e-11 PF00155: Aminotran_1_2" amino acids 37 to 162 (126 residues), 37.4 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 97% identical to ARNB_SERP5: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07806, UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC: 2.6.1.87] (inferred from 97% identity to spe:Spro_2154)

MetaCyc: 70% identical to UDP-4-amino-4-deoxy-L-arabinose aminotransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1863 [EC: 2.6.1.87, 2.6.1.92]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.87 or 2.6.1.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI46_11015 UDP-4-amino-4-deoxy-L-arabinose aminotransferase (Serratia liquefaciens MT49)
MDQFLPFSRPAIGDEEIAAVEKVLRSGWITTGPQNQQLESEFCATFGCKHAIAVCSATAG
MHITLMALGIGPGDEVITPSQTWVSTLNMIELLGATPVMIDVDRDTLMVNAKDVEAAITT
KTKAIVPVHYAGAPLPMDALRDVAKRHNLPLIEDAAHAVGSRYNGEWVGAQGTAIFSFHA
IKNLTCAEGGLIATDDDVLADRLRCLKFHGLAVDAFDRQQLGRKPQAEVVEPGYKYNLSD
IHAAIAVVQLARLPQLNARRKELAQRYLTALEGSPFLPLGLPDYPHDHAWHLFMVRVDAE
RCGIDRDQLMERLKEVGIGTGLHFRAAHTQKFYRDRYPQLSLPNTEWNSARLCTLPLFPD
MTDADVDRVVKALSSVVESLRVSR