Protein Info for IAI46_11010 in Serratia liquefaciens MT49

Annotation: vitamin B12 ABC transporter ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00005: ABC_tran" amino acids 15 to 163 (149 residues), 72.5 bits, see alignment E=5.7e-24

Best Hits

Swiss-Prot: 66% identical to BTUD_YERE8: Vitamin B12 import ATP-binding protein BtuD (btuD) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_2095)

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>IAI46_11010 vitamin B12 ABC transporter ATP-binding protein BtuD (Serratia liquefaciens MT49)
MLQLRQVGVEGRLAPFSAQVDAGLQFHLIGPNGAGKSTLLACLAGILPGIGEILLDGHPL
KSFQGNELALRRGYLSQQQPPVALMPVFQYLALHQPAGASEEALESTILYLCQRLKLMDK
LPRMLTQLSGGEWQRVRLAAVLLQVWPTVNPYSQLLLLDEPTNSLDVAQKVALDRLLREF
CQSGRSALVCAHDLNHTLQQADRVWLLHAGRLVAQGSTREVMEPVLLSQIYDVDFHLQAV
GDQRWIMTKTA