Protein Info for IAI46_10965 in Serratia liquefaciens MT49

Annotation: 50S ribosomal protein L35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01632: Ribosomal_L35p
  • amino acids 2 to 61 (60 residues), 84.9 bits, E=2.2e-28
• TIGR00001: ribosomal protein bL35
  • amino acids 2 to 64 (63 residues), 91 bits, E=2.2e-30

Best Hits

Swiss-Prot: 97% identical to RL35_SERP5: 50S ribosomal protein L35 (rpmI) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02916, large subunit ribosomal protein L35 (inferred from 92% identity to ddc:Dd586_1945)

MetaCyc: 91% identical to 50S ribosomal subunit protein L35 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L35p" in subsystem Ribosome LSU bacterial

Protein Sequence (65 amino acids)

>IAI46_10965 50S ribosomal protein L35 (Serratia liquefaciens MT49)
MPKIKTVRGAAKRFKKTGSGGFKRKHANLRHILTKKATKRKRHLRPKGMVSKNDLVLVTA
CLPYA