Protein Info for IAI46_10960 in Serratia liquefaciens MT49

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05198: IF3_N
  • amino acids 15 to 84 (70 residues), 117.3 bits, E=2.6e-38
• TIGR00168: translation initiation factor IF-3
  • amino acids 15 to 182 (168 residues), 244.4 bits, E=2.3e-77
• PF00707: IF3_C
  • amino acids 91 to 180 (90 residues), 113.3 bits, E=4.2e-37

Best Hits

Swiss-Prot: 98% identical to IF3_YERP3: Translation initiation factor IF-3 (infC) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 97% identity to eay:EAM_1628)

Predicted SEED Role

"Translation initiation factor 3"

Protein Sequence (183 amino acids)

>IAI46_10960 translation initiation factor IF-3 (Serratia liquefaciens MT49)
MKGGKRVQPARPNRINREIRAQEVRLTGVDGEQIGIVSLNEALEKAEEAGVDLVEISPNA
EPPVCRIMDYGKFLYEKSKSTKEQKKKQKVIQVKEIKFRPGTDDGDYQVKLRNLIRFLED
GDKAKITLRFRGREMAHQQIGMEVLNRVRKDLCEDSDLAIVESFPTRIEGRQMIMVLAPK
KRQ