Protein Info for IAI46_10930 in Serratia liquefaciens MT49

Annotation: MarC family NAAT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details PF01914: MarC" amino acids 5 to 218 (214 residues), 205.3 bits, see alignment E=3.6e-65 TIGR00427: membrane protein, MarC family" amino acids 6 to 214 (209 residues), 121.6 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 80% identical to MARC_ECOK1: UPF0056 inner membrane protein MarC (marC) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 94% identity to srs:SerAS12_2081)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>IAI46_10930 MarC family NAAT transporter (Serratia liquefaciens MT49)
MLQLFQAIGLGLVLLLPLANPLTTVALLLGLSGNMTREERNQQSLMASIYVFFIMTVAFY
AGQVVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQSAEDAPEVETKSNELRKKTSANIA
FVPLAMPSTAGPGTIAMIISSASSIHENTLGFAHWVLLVAPVAIFFSVAFILWVCLRSSG
AIMRLVGKSGIEAISRLMGFLLVCMGVQFIINGVLEIISTYVPAA