Protein Info for IAI46_10905 in Serratia liquefaciens MT49

Annotation: gluconate 2-dehydrogenase subunit 3 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details amino acids 40 to 40 (1 residues), see Phobius details transmembrane" amino acids 37 to 39 (3 residues), see Phobius details PF13618: Gluconate_2-dh3" amino acids 59 to 214 (156 residues), 136.6 bits, see alignment E=3.8e-44

Best Hits

Swiss-Prot: 68% identical to GADH3_PANCY: Gluconate 2-dehydrogenase subunit 3 from Pantoea cypripedii

KEGG orthology group: K06152, gluconate 2-dehydrogenase gamma chain [EC: 1.1.99.3] (inferred from 97% identity to spe:Spro_2136)

MetaCyc: 63% identical to D-gluconate dehydrogenase 21.7 kD subunit (Pseudomonas fluorescens)
Gluconate 2-dehydrogenase (acceptor). [EC: 1.1.99.3]

Predicted SEED Role

"Gluconate 2-dehydrogenase (EC 1.1.99.3), membrane-bound, gamma subunit" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.3

Use Curated BLAST to search for 1.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI46_10905 gluconate 2-dehydrogenase subunit 3 family protein (Serratia liquefaciens MT49)
MSDDKTNNSRRDFLLKSMTLIPAAVIGGSGVSALTAPIPAVAATDTSKQPDYQPTFFTPE
EWAFVKAAVARLIPADERGPGALEAGVPEFIDRQMNTPYATGSIWYMQGPFNPDAPKEMG
YQLPLVPKQIYNLGIADADAYCKKTAGKPFAELDAAQQDALLQKFESGEAEFSQLPAKLF
FSYLLQNTREGFFSDPIHGGNKDMVGWKLINFPGARADFMDWVERGERYPLPPVSIRGER
G