Protein Info for IAI46_10880 in Serratia liquefaciens MT49

Annotation: iron/manganese ABC transporter permease subunit YfeC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 265 (256 residues), 300.3 bits, see alignment E=1.3e-93 PF01032: FecCD" amino acids 43 to 243 (201 residues), 33.2 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 92% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 99% identity to spe:Spro_2131)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI46_10880 iron/manganese ABC transporter permease subunit YfeC (Serratia liquefaciens MT49)
MLELLLQPFSYNYMVKAIWVSAIVGAACAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYA
LGLPYAAGAFFTGMLAALAMTLVRHVTRLREDAIIGFIFSTFFAVGLLIVSLNPTSVNVQ
SIIFGNILGIADEDVLQVEIIIGVSLLILCLVWKDLLAVFFDENHAVSIGLSPLRLKILF
FTLLSACTVAALQTVGAILVIAMVITPGATAYLLTDRFSRLVIIAIVIGALTSGLGAYLS
FFLDGATGGVIVTLQTLVFLAAFFFAPKHGLLASKRRVAREQTGGH