Protein Info for IAI46_10875 in Serratia liquefaciens MT49

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 57 to 85 (29 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 268 (255 residues), 326.1 bits, see alignment E=1.8e-101 PF01032: FecCD" amino acids 61 to 260 (200 residues), 32.6 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 87% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 97% identity to spe:Spro_2130)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI46_10875 metal ABC transporter permease (Serratia liquefaciens MT49)
METLYQLLSEPFAYPFMQRAILAAIVTGVVCAVLSCYLVLKGWSLMGDAISHAVLPGIVV
AFVLGIPVVIGAFFSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRIDTDQ
HLSHILFGNMLGITDAELKQTLLMAGITLLVVLLKRKDLMLYCFDPNHARVIGLPVKLLH
YGLLCLLALTIVASLQAVGVILVIAMLIAPGIIAFMLCRSFDRMLIVATVVSVFSCVLGT
LISFHIDGATGPCIVIVQAILFVFALLYSKFKPLQRHENGMLDAKP