Protein Info for IAI46_10845 in Serratia liquefaciens MT49

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04307: YdjM
  • amino acids 1 to 162 (162 residues), 128.9 bits, E=7.2e-42

Best Hits

Swiss-Prot: 71% identical to YDJM_ECOLI: Inner membrane protein YdjM (ydjM) from Escherichia coli (strain K12)

KEGG orthology group: K07038, inner membrane protein (inferred from 99% identity to spe:Spro_2124)

Predicted SEED Role

"Membrane-bound metal-dependent hydrolase YdjM, induced during SOS response"

Protein Sequence (182 amino acids)

>IAI46_10845 metal-dependent hydrolase (Serratia liquefaciens MT49)
MTAEGHLIFSVACAIFAKKAEVTPELATGDWWHIIPAALLTSLLPDIDHPKSVLGQRLRW
IAIPISRAFGHRGFTHSLLAIAGGMALFQLDVPRSWPIPADVLHAMIIGYFSHLLADMLT
PAGVPLLWPCRWRFRLPLLNSQKGNQLERALCLCLVAFAIYWQGGCTIPVQSYFEQIKNI
RL