Protein Info for IAI46_10840 in Serratia liquefaciens MT49

Annotation: L-cystine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF00375: SDF" amino acids 29 to 442 (414 residues), 358.9 bits, see alignment E=1.8e-111

Best Hits

Swiss-Prot: 87% identical to YDJN_ECOLI: L-cystine transporter YdjN (ydjN) from Escherichia coli (strain K12)

KEGG orthology group: K06956, (no description) (inferred from 100% identity to spe:Spro_2123)

MetaCyc: 87% identical to cystine/sulfocysteine:cation symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-285; TRANS-RXN-286; TRANS-RXN-330; TRANS-RXN0-616

Predicted SEED Role

"L-cystine uptake protein TcyP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>IAI46_10840 L-cystine transporter (Serratia liquefaciens MT49)
MNFPLVINVVIFVALLLLLAQSRHKQWSLAKKVLVGLVMGVVFGLALQLVYGSDNPVLKE
SISWFNIVGNGYVQLLQMIVMPLVFASILSAVAKLHNASSLGKISFLTIGTLLFTTLISA
LVGVLVTNLFGLTAEGLVQGAQESARLSAIQSNYVGKLADLTVPQMVLSFIPKNPFADLT
GASPTSIISVVIFATFLGVASLQLLKDDKPKGERVLVAIDTLQAWVMKLVRLVMKLTPYG
VLALMTKVVAGSNVQDIIKLGSFVVASYLGLAIMFAVHAALLAFTGVNPLKFFRKVWPVI
TFAFTSRSSAASIPLNVEAQTRRLGVPESIASFSASFGATIGQNGCAGLYPAMLAVMVAP
TVGINPLDPVWIATLVGIVTISSAGVAGVGGGATFAALIVLPAMGLPVTLVALLISVEPL
IDMGRTALNVNGSMAAGTITSQLMKQTDKSIMDSEDEVELAHQ