Protein Info for IAI46_10835 in Serratia liquefaciens MT49

Annotation: phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 3 to 257 (255 residues), 370.6 bits, see alignment E=3.5e-115 PF00702: Hydrolase" amino acids 4 to 198 (195 residues), 60.1 bits, see alignment E=2e-20 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 35 to 203 (169 residues), 55.1 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 78% identical to PHNX_KLEP7: Phosphonoacetaldehyde hydrolase (phnX) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 78% identity to kpu:KP1_5437)

MetaCyc: 64% identical to phosphonoacetaldehyde hydrolase (Vibrio splendidus)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>IAI46_10835 phosphonoacetaldehyde hydrolase (Serratia liquefaciens MT49)
MSQINAVILDWAGTTVDFGSFAPTQIFVEAFKQTFDIDISLAEARIPMGLGKWQHIEALG
KLPEVDARWRQQLGRSMSHQDIDALYQAFMPLQIAKVVDFADPIEGVPQVIAALREQGIK
IGSCSGYPRAVMEVLAPAAALRGYAPDHWVATDDLAAGGRPGPWMALQNVITLGIDSVAH
CVKVDDAVPGISEGLNAGMWSIGLALSGNEFGATWQEYQQMSESEVNKRRALATDKLYSA
GAHYVIDTLAQLPDVIAEINQRLAAGERP