Protein Info for IAI46_10830 in Serratia liquefaciens MT49

Annotation: 2-aminoethylphosphonate--pyruvate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 4 to 365 (362 residues), 615.2 bits, see alignment E=3.7e-189 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 7 to 363 (357 residues), 504.5 bits, see alignment E=1.9e-155 PF00266: Aminotran_5" amino acids 40 to 311 (272 residues), 77.2 bits, see alignment E=1.3e-25 PF00155: Aminotran_1_2" amino acids 61 to 358 (298 residues), 21.6 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 77% identical to PHNW_SALSV: 2-aminoethylphosphonate--pyruvate transaminase (phnW) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 77% identity to sew:SeSA_A0491)

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>IAI46_10830 2-aminoethylphosphonate--pyruvate transaminase (Serratia liquefaciens MT49)
MSEHDYLLLTPGPLTTSKTVKEAMLFDSCTWDEDYNLGVVQNIRQKLEALATRSTGYTSV
LLQGSGSFAVEAVLGTVMGPQDKLLIVNNGAYGARMIEMARLMDINHHAFNCGEVNEPDV
EAMEAVLKGDAGISHIAMVHCETTTGMLNPLERVSGLAARNGKTLIVDAMSSFGGIPLDV
DALGIDYLISSANKCIQGVPGFAFVIARRNELNKCAGRSRSLSLDLYAQWRCMEDNAGKW
RFTSPTHTVLAFAQALRELEQEGGIDARHARYRANQQRLVAGMRALGFETLLEDDLHSPI
ITAFYSPKADTYRFTEFYQRLKQQGFVIYPGKVSQSDCFRIGNIGEVYPQDIERLLAAVG
QAMYWEQ