Protein Info for IAI46_10820 in Serratia liquefaciens MT49

Annotation: DNA-binding transcriptional regulator KdgR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF09339: HTH_IclR" amino acids 15 to 64 (50 residues), 53.2 bits, see alignment 3.1e-18 PF01614: IclR" amino acids 129 to 254 (126 residues), 145.1 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 82% identical to KDGR_DICCH: Pectin degradation repressor protein KdgR (kdgR) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 94% identity to spe:Spro_2122)

Predicted SEED Role

"Transcriptional regulator KdgR, KDG operon repressor" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>IAI46_10820 DNA-binding transcriptional regulator KdgR (Serratia liquefaciens MT49)
MVNADPDKQPDAVSSVLKVFGILQALGEEREIGITELSQRVMMSKSTVYRFLQTMKSLGY
VSQEGETEKYALTLKLFELGAKSLQNVDLIRIADVQMRELSNHTREAIHLGALDEDSIVY
IHKIDAQYNLRMYSRIGRRNPLHSTAIGKVLLAWRDRAEVAQILSQIEFTRSTPNTLTDA
GALLSLLDQVREQGVGEDIEEQEAGLRCIAVPVFDRFGVVTAGLSISFPSIRYSEDARAD
YVKRLHTAARNISEQMGYHDYPY