Protein Info for IAI46_10815 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 411 (391 residues), 173.7 bits, see alignment E=2.7e-55 amino acids 276 to 461 (186 residues), 55.8 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 74% identical to YEBQ_ECOLI: Uncharacterized transporter YebQ (yebQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_2061)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>IAI46_10815 MFS transporter (Serratia liquefaciens MT49)
MRSCTDGLPVPQRYGAILAIALGITVSVLDGAIANVALPTIARDLNASPASSIWVVNAYQ
LAITISLLSLASLGDLIGYRRIYQAGLLVFSVTSLFCALSDSLTTLTIARVLQGFGAAAI
MSVNTALIRIIYPQRFLGRGMGINSLIVAFSSAAGPTVAAAILSVASWQWLFAINLPIGI
VALLLGMKYLPANSQKSTNQRFDPTSAVMNALTFGLLITAISGFAQGQSLTLIFSEIAAL
LVIGFFFVRRQLRQEFPLLPVDLLRIPIFALSMGTSICSFTAQMLAMVSLPFFLQGTLGR
DEVATGLLLTPWPLAIIVMAPLAGRLVERIHAGLLGCIGLAVFALGLFLLALLPHNPSDL
DIIWRMVLCGAGFGLFQSPNNHTIISAAPRNRSGGASGMLGTARLLGQTSGAALVALMFN
LFPTSGTHASLILAGTFATLAAAVSSLRITQPRAQAVENREQAK