Protein Info for IAI46_10645 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 336 to 361 (26 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 225 (205 residues), 104.2 bits, see alignment E=8.4e-34 amino acids 233 to 422 (190 residues), 38.3 bits, see alignment E=8e-14 PF07690: MFS_1" amino acids 55 to 238 (184 residues), 60.5 bits, see alignment E=1.4e-20 amino acids 257 to 429 (173 residues), 53.3 bits, see alignment E=2.2e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to spe:Spro_2084)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>IAI46_10645 MFS transporter (Serratia liquefaciens MT49)
MDTQTTVIDARQSRQALLAGSVGNFIEWYEFGVYGFLATVIAANFFTLQGESEITSLILT
YAAFALAFFCRPIGAVIFGRIGDRIGRRPTLIAVLLLMTVATALIGVMPTYASIGVAAPL
LLTLLRMFQGLFAGGEFGGAVSLMTEFAPKGKRGLFGAWQSLTVAFGLLAGAGLVALLAA
LLTPEQLHDWGWRIPFLLALPMGAVALWLRLKLQETPTFTQAQQNLGTKVHAPELKLSGV
VKTIAIGIGRMMGWSAAGYTFLVVMPSYLQTSLHATFQQALVATVLANVGFALTILPAGI
LSDKLGRKTVMLTAVVAVILFTFPLLHLLQDPQSSLLAKGIAVMIAGAVVGLLAGPGPAM
LAEMFPTQVRYTGLGLAYSLSNAVFSGSAGLIITGLIKQTGNLDIPAYYVVATSVVSLFA
LMTLRRDDHLRSLNER