Protein Info for IAI46_10640 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details PF01306: LacY_symp" amino acids 5 to 401 (397 residues), 454.3 bits, see alignment E=5.7e-140 TIGR00882: oligosaccharide:H+ symporter" amino acids 7 to 397 (391 residues), 452.4 bits, see alignment E=6.7e-140 PF12832: MFS_1_like" amino acids 10 to 374 (365 residues), 70.8 bits, see alignment E=1.7e-23 PF07690: MFS_1" amino acids 14 to 334 (321 residues), 73.7 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 97% identity to spe:Spro_2083)

Predicted SEED Role

"Sucrose permease, major facilitator superfamily" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>IAI46_10640 MFS transporter (Serratia liquefaciens MT49)
MNRETKKYYVLLSGLLFFFFFTWSSSFSLISIWLNQKIGLKGTETGLIFSAMSIMALCAQ
PLYGFIQDKLGLRKHLLLFVGVLLLLTGPFFIYVYAPLLQTNLVAGALVGGVFVSLAFNA
GIGALESYTERVSRIVGFEFGRARMWGSLGWASATFFAGFIYNINPNINFWIASASAAVF
LLLLWQVRELKPNAMAGLEYGKPENLKLQDALALLRLPGFWALVVFVLGTSIYGVFDQQF
PVYFASQFATHEEGNRMYGFLNSLQVFLEAGGMFLAPLLVNRIGIKQSLLLASSVMALRM
FGSGFASGALMISAMKLLHAVELPILLVAMFKYITTRFDSRLSSTLYLVGFQFISQIVAG
ILAPLAGYGYDRIGFADTYLLMGCAVAGTTLISCFLLRGETVARTPQFQSTIKSSEPTQ