Protein Info for IAI46_10635 in Serratia liquefaciens MT49

Annotation: glycoside hydrolase family 32 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 17 to 449 (433 residues), 465.7 bits, see alignment E=7.4e-144 PF00251: Glyco_hydro_32N" amino acids 28 to 329 (302 residues), 355 bits, see alignment E=4.4e-110 PF08244: Glyco_hydro_32C" amino acids 333 to 474 (142 residues), 84.3 bits, see alignment E=9.6e-28

Best Hits

Swiss-Prot: 57% identical to CSCA_ECOLX: Sucrose-6-phosphate hydrolase (cscA) from Escherichia coli

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 88% identity to spe:Spro_2082)

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.26, 3.2.1.B3

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>IAI46_10635 glycoside hydrolase family 32 protein (Serratia liquefaciens MT49)
MKNALAQADHAVEALRAQRQDDYYPQFHLAAAAGWINDPNGLVYINGVYHAFYQHHPYDQ
NWGPMHWGHATSRDLAHWQHQPIALAPGESYDKDGCFSGCAVDDNGVLTLLYTGHVWLGK
EGDDDQVREVQCLATSEDGVNFVKHGPVLLPPEGIQHFRDPKVWRAADCWWMVVGAKENG
LGQARLYRSNDLRDWQFDRVLAGAQSPHQGYMWECPDFFPLGEKQVLLFSPQGLTAQGYR
NRNRFQSGYLLGHWRPDEDFSVTQSFCELDGGHDFYAPQTFTAADGRRMLFAWMDMWESP
MPSKPHGWAGALTLPRELTLSCEGNVLMNPARELTALRGEQQSFDAVSIRNQRQMLTDGV
QELALTLNVAASDAERYGIVIGTAARLYVDNQTHRLVLERFSEDPGLCGCRSVPLPEANI
LSLRVFIDRSSLEVFVNHGEACLTSRIYPTDGQRSVTLFAEGGLAQFGAAQAWELESIWE