Protein Info for IAI46_10610 in Serratia liquefaciens MT49

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR01224: imidazolonepropionase" amino acids 28 to 405 (378 residues), 514 bits, see alignment E=1e-158 PF01979: Amidohydro_1" amino acids 64 to 381 (318 residues), 73 bits, see alignment E=2.8e-24 PF07969: Amidohydro_3" amino acids 127 to 380 (254 residues), 58.8 bits, see alignment E=7.6e-20

Best Hits

Swiss-Prot: 94% identical to HUTI_SERP5: Imidazolonepropionase (hutI) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 94% identity to srs:SerAS12_2016)

MetaCyc: 65% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>IAI46_10610 imidazolonepropionase (Serratia liquefaciens MT49)
MTSEIHCDSLWHGADVVTMRDGKYHTITNGAIAVRDGKIVWLGEHAALPANLIADETVKF
DGGIITPGFVDCHTHLVFGGNRSGEFEQRLNGVSYADIAAQGGGIISTVKATRDADEELL
LEQALFRLRPLLAEGVTCVEIKSGYGLTPESELKMLRVARKLGELLPVEVKTTCLAAHAL
PPEYAHRADDYIDLVCNTIIPQAAAAGLADAVDAFCEHLAFSPAQVARVFAAAEKAGLPV
KLHAEQLSALGGSELAAQHHALSADHLEYATAQDARAMGDAGTVAVLLPGAYYLLRETQC
PPVDLFRKHGVAMAIASDANPGTSPALSLRLMINMACTLFRLTPEEALAGVTVHAAKALG
LQASQGTLEAGKLADFVHWPLSRPAELAYWLGGQLPCTVIFRGEVRQ