Protein Info for IAI46_10580 in Serratia liquefaciens MT49

Annotation: nucleoside-specific channel-forming protein Tsx

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03502: Channel_Tsx
  • amino acids 31 to 291 (261 residues), 288.2 bits, E=3.1e-90

Best Hits

Swiss-Prot: 75% identical to TSX_KLEPN: Nucleoside-specific channel-forming protein Tsx (tsx) from Klebsiella pneumoniae

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 94% identity to spe:Spro_2072)

MetaCyc: 74% identical to nucleoside-specific channel-forming protein Tsx (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-468

Predicted SEED Role

"Nucleoside-specific channel-forming protein Tsx precursor"

Protein Sequence (291 amino acids)

>IAI46_10580 nucleoside-specific channel-forming protein Tsx (Serratia liquefaciens MT49)
MKKIALAAGVLLAASYSASSMADSKDSQYVSDWWHQSVNVVGSYHTRFGPQLNNDLYLEY
EAFAKKDWFDFYGYIDVPKFFGVGNTPDRGIWDKGSPMFMEIEPRFSIDKLTGTDLSFGP
FKEWYFANNYIYDLGHNADGRQNTWYMGLGTDIDTGLPMSLSMNIYAKYQWENYQAANEN
SWDGYRFKVKYFVPLTQVWGGNLSYIGFTNFDFGSDLGKDDFTVNGRQARTSNSIASSHI
LALNYDHWHYSFVARYFHNGGQWQDGVDIGTPQGPIKSTGWGYYIVAGYNF