Protein Info for IAI46_10570 in Serratia liquefaciens MT49

Annotation: aromatic amino acid DMT transporter YddG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF00892: EamA" amino acids 10 to 141 (132 residues), 31.3 bits, see alignment E=1.1e-11 amino acids 163 to 289 (127 residues), 36.8 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 59% identical to YDDG_SALT1: Methyl viologen resistance protein YddG (yddG) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: None (inferred from 94% identity to spe:Spro_2070)

MetaCyc: 56% identical to amino acid exporter YddG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-265

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>IAI46_10570 aromatic amino acid DMT transporter YddG (Serratia liquefaciens MT49)
MSSLSAQYKATLLGLLAILLWSSVVGLIRSVSEGLGPIGGAAMIYSVSAVFLLLALRMPN
LRLFPRPYLLLGSLLFVSYEICLSLSLGYANTRLQAIEVGMINYLWPCFTVLMALVFNGQ
KARWWLLPGLLLSLFGIGWIMSGEGGWSPAQMLENVRSNPLSYSLAFGGAVIWALYCNLT
KKIAQGHNGVVLFITLTAVALWLKYAFSSESGMQFTLPVTLTLLCAGMAMGAGYAAWNVG
ILRGNMTLLATASYFTPVLSAVFAALVLNTALTANFWQGVVMVTAGSLICWRATRGN