Protein Info for IAI46_10555 in Serratia liquefaciens MT49

Annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 8 to 224 (217 residues), 218.9 bits, E=7.4e-69
• PF00117: GATase
  • amino acids 59 to 240 (182 residues), 48 bits, E=1.3e-16

Best Hits

Swiss-Prot: 75% identical to PUUD_SHISS: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Shigella sonnei (strain Ss046)

KEGG orthology group: K09473, gamma-glutamyl-gamma-aminobutyrate hydrolase [EC: 3.5.1.94] (inferred from 96% identity to spe:Spro_2067)

MetaCyc: 75% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Protein Sequence (253 amino acids)

>IAI46_10555 gamma-glutamyl-gamma-aminobutyrate hydrolase (Serratia liquefaciens MT49)
MGNIFNRPVVGVVMCRYRLNGHLTQTLQEKYLNAVIAAGGLPIALPHALAEPKLLEELLP
QLDGILLPGSPSNVQPHLYGENGDEPDADPGRDELSLALIRHSLDRRIPLFAICRGMQEM
VVATQGALHRRLYELPELLEHREDHDLPLEQQYAPAHEVIVQEGGLLSQLIPDCNRFWVN
SLHGQGAKTLGSSVRIEAHAADGLVEAISLRDQPFALGVQWHPEWNSEEYALSRLLFEGF
ISACRNYQKEKRP