Protein Info for IAI46_10535 in Serratia liquefaciens MT49

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 194 (189 residues), 176.2 bits, E=8.6e-56
• PF08659: KR
  • amino acids 8 to 157 (150 residues), 34.6 bits, E=2.7e-12
• PF13561: adh_short_C2
  • amino acids 12 to 242 (231 residues), 221.9 bits, E=1.4e-69

Best Hits

Swiss-Prot: 39% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 99% identity to spe:Spro_2063)

MetaCyc: 97% identical to meso-butanediol dehydrogenase [(R)-acetoin-forming] (Serratia marcescens H30)
(S,S)-butanediol dehydrogenase. [EC: 1.1.1.76]; RXN-11032 [EC: 1.1.1.76, 1.1.1.304]; 1.1.1.- [EC: 1.1.1.76, 1.1.1.304]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (40/53 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (16/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• superpathway of 2,3-butanediol biosynthesis (5/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (7/9 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• (S,S)-butanediol biosynthesis (1/1 steps found)
• (S,S)-butanediol degradation (1/1 steps found)
• meso-butanediol biosynthesis I (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• oleate biosynthesis IV (anaerobic) (10/14 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• streptorubin B biosynthesis (15/34 steps found)
• mycolate biosynthesis (16/205 steps found)
• superpathway of mycolate biosynthesis (17/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.304 or 1.1.1.76

Protein Sequence (251 amino acids)

>IAI46_10535 SDR family oxidoreductase (Serratia liquefaciens MT49)
MRFDNKVVVITGAGNGMGEAAARRFSAEGATVVLADWAKEAVDKVAASLPKGRALAVHID
VSDHVAVEKMMNEVAEKLGRIDVLLNNAGVHVAGSVLETSVADWRRIAGVDIDGVVFCSK
FAMPYLLKTKGCIVNTASVSGLGGDWGAAYYCAAKGAVVNLTRAMALDHGGDGVRVNSVC
PSLVKTNMTNGWPQEIRDKFNERIALGRAAEPEEVAAVMAFLASDDASFINGANIPVDGG
ATASDGQPKIV