Protein Info for IAI46_10475 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 114 (2 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 374 (28 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 341 (314 residues), 120.7 bits, see alignment E=7.1e-39 PF00083: Sugar_tr" amino acids 57 to 189 (133 residues), 36.1 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 70% identity to srr:SerAS9_1989)

Predicted SEED Role

"probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>IAI46_10475 MFS transporter (Serratia liquefaciens MT49)
MSAIKPETLNATLDTPTTHWPAIANVVLAGIAVALHVGKATIALPELQREFGRSLESLSW
IISAFPFIGVFGGIAAGLLVRRWGDRRLLGLGLVIVSIASFVGAAQHNFIGLIVTRAIEG
IGFVIVVVSAPTVLTRVVSAQKRNLVFSIWSTFMPAGMAISLFFGPHFSNWQQSWIAGGI
LTLLAALLLPFTTPRAAVTTSSAVALKLRQALVSILRARQPLLLALIFTTYNLQFFAVMA
FLPIFLMQRIGLTLAVAGGISAAVIAVNILGNLAAGVLLSRGLRARNLLAVVSLLMGLAG
TGVFLSVTPNALLIPLCLVFSAIGGMMPATILAATPAAAPEPGLIPLSLGLVMQGIYLGQ
VIGPIVLSALVAYAGWSAPAGMVLAAALLGSILALALASKTRA